PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2491_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family G2-like
Protein Properties Length: 372aa    MW: 40917.1 Da    PI: 8.6119
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2491_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.88.8e-32201256156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+peLH+rF++a++qLGGs+ AtPk+i+e mkv+gLt+++vkSHLQkYRl+
  Neem_2491_f_1 201 KQRRCWSPELHRRFLHALQQLGGSHAATPKQIREQMKVDGLTNDEVKSHLQKYRLH 256
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-28198259IPR009057Homeodomain-like
SuperFamilySSF466891.25E-17198259IPR009057Homeodomain-like
PROSITE profilePS5129414.887198258IPR017930Myb domain
TIGRFAMsTIGR015576.4E-27201256IPR006447Myb domain, plants
PfamPF002491.4E-7203254IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MDYAEKMQRC HEYVEALEEE KRKIQVFQRE LPLSIEACRR ELSGTTTEYM HGQSECSEQT  60
SSDVPVLEEF MPIKRSSSSE DNDEQHSHKN TTSNREKNSD KKKSDWLRSV QLWNQSPDPL  120
PKEDVPRKTT VVEVKRNNGG AFQPFQREKS VGKTEQSAGK VNSSLPAPAA SSTTETVTKG  180
GGGGGSGSSK KDEKEGQTQR KQRRCWSPEL HRRFLHALQQ LGGSHAATPK QIREQMKVDG  240
LTNDEVKSHL QKYRLHTRRP TPSIHGNSNP QAPQFVVVGG IWVQPPEYAT VTAKSSAEAS  300
TMTAANGIYA PLAAPPPALT QSSSPMQRPQ QAQSDHLQSE ERGSHSEGGG AHHSNSPATS  360
SSTHTTTASP AF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437730.11e-173hypothetical protein CICLE_v10031793mg
TrEMBLV4TH641e-173V4TH64_9R
STRINGVIT_01s0011g03110.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34912863
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-103G2-like family protein